Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00077
Active Ingredients: Becaplermin
DRUGBANK Accession Number: DB00102
Active Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Sequence Length: 109
Type: Biotech
Description: Becaplermin is a recombinant form of human platelet-derived growth factor used to treat ulcers due to diabetic neuropathy in the lower extremities when there is adequate blood supply to the area.
Disease: Ulcers due to diabetic neuropathy in the lower extremities when there is adequate blood supply to the area