Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00073
Active Ingredients: Palifermin
DRUGBANK Accession Number: DB00039
Active Sequence: SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Sequence Length: 130
Type: Biotech
Description: Palifermin is a form of recombinant human keratinocyte growth factor used to prevent and treat oral mucositis following radiation or chemotherapy.
Disease: Oral mucositis following radiation or chemotherapy