Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00070
Active Ingredients: Sargramostim
DRUGBANK Accession Number: DB00020
Active Sequence: APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Sequence Length: 127
Type: Biotech
Description: Sargramostim is a modified form of recombinant human granulocyte-macrophage colony stimulating factor used to increase immune cell production after myelosuppressive therapy or bone marrow transplant.
Disease: Mmyelosuppressive therapy; bone marrow transplant