Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00068
Active Ingredients: Sermorelin
DRUGBANK Accession Number: DB00010
Active Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Sequence Length: 30
Type: Biotech
Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues