Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00061
Active Ingredients: Pramlintide
DRUGBANK Accession Number: DB01278
Active Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Sequence Length: 37
Type: Small Molecule
Description: Pramlintide is an amylin analog used for the management of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.