Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00029
Active Ingredients: Lixisenatide
DRUGBANK Accession Number: DB09265
Active Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Sequence Length: 44
Type: Small Molecule
Description: Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist used in the treatment of type 2 diabetes mellitus (T2DM). It is sold under the brand name Adlyxin by Sanofi-Aventis. Adlyxin recieved FDA approval July 28, 2016.