Warning: mysqli_fetch_assoc() expects parameter 1 to be mysqli_result, boolean given in /home/wwwroot/hordb/druginfor.php on line 21
Protein Information
ID: hd00004
Active Ingredients: Corticotropin
DRUGBANK Accession Number: DB01285 (DB09547)
Active Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence Length: 39
Type: Biotech
Description: Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
Disease: Multiple inflammatory diseases; West syndrome