Protein Information

• ID:  hd00002
• Active Ingredients:  Human Calcitonin
• DRUGBANK Accession Number:  DB06773
• Active Sequence:  CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
• Sequence Length:  32
• Type:  Biotech
• Description:  Calcitonin was first discovered in isolated parathyroid tissue as a substance with a serum-calcium-lowering effect. It is constituted as a 32-amino acid single chain polypeptide structure that gets secreted as a regulatory agent in calcium-phosphorus metabolism.It is used as an alternative for people developing antibodies against salmon calcitonin.
• Disease:  
• CAS:  21215-62-3
• SMILES:  CCC(C)C(C(=O)NCC(=O)NC(C(C)C)C(=O)NCC(=O)NC(C)C(=O)N1CCCC1C(=O)N)NC(=O)C(C)NC(=O)C(C(C)O)NC(=O)C(CCC(=O)N)NC(=O)C2CCCN2C(=O)C(CC3=CC=CC=C3)NC(=O)C(C(C)O)NC(=O)C(CC4=CNC=N4)NC(=O)C(CC5=CC=CC=C5)NC(=O)C(CCCCN)NC(=O)C(CC(=O)N)NC(=O)C(CC6=CC=CC=C6)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)O)NC(=O)C(CC7=CC=C(C=C7)O)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(C)C)NC(=O)C(CCSC)NC(=O)C8CSSCC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N8)C(C)O)CO)CC(C)C)CC(=O)N)N