General Information

  • ID:  hor007291
  • Uniprot ID:  Q9VD83
  • Protein name:  Bursicon
  • Gene name:  NA
  • Organism:  Drosophila melanogaster
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in one to two pairs of neurons in each of the thoracic and abdominal neuromeres of the larval CNS. Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with pburs in four bilater
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila.
  • GO MF:  GO:0031395 bursicon neuropeptide hormone complex; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043195 terminal bouton
  • GO BP:  GO:0048018 receptor ligand activity; GO:0005179 hormone activity; GO:0036122 BMP binding; GO:0046982 protein heterodimerization activity
  • GO CC:  GO:0009887 animal organ morphogenesis; GO:0030709 border follicle cell delamination; GO:0007298 border follicle cell migration; GO:0007593 chitin-based cuticle sclerotization; GO:0048067 cuticle pigmentation; GO:0036335 intestinal stem cell homeostasis; GO:0038098 sequestering of BMP from receptor via BMP binding; GO:0005179; F:hormone activity; IMP:UniProtKB.

Sequence Information

  • Sequence:  QPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEGPLNNHFRRIALQ
  • Length:  141
  • Propeptide:  MLRHLLRHENNKVFVLILLYCVLVSILKLCTAQPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEGPLNNHFRRIALQ
  • Signal peptide:  MLRHLLRHENNKVFVLILLYCVLVSILKLCTA
  • Modification:  T129 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA