General Information

  • ID:  hor007290
  • Uniprot ID:  Q9UNG2
  • Protein name:  Tumor necrosis factor ligand superfamily member 18
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Tumor necrosis factor family
  • Source:  Human
  • Expression:  Expressed at high levels in the small intestine; ovary; testis; kidney and endothelial cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0032813 tumor necrosis factor receptor superfamily binding; GO:0005102 signaling receptor binding; GO:0042802 identical protein binding; GO:0005125 cytokine activity
  • GO CC:  GO:0042129 regulation of T cell proliferation; GO:0033209 tumor necrosis factor-mediated signaling pathway; GO:0043066 negative regulation of apoptotic process; GO:0045785 positive regulation of cell adhesion; GO:0002687 positive regulation of leukocyte migration; GO:0051092 positive regulation of NF-kappaB transcription factor activity; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0007165 signal transduction; GO:0002309 T cell proliferation involved in immune response; GO:0007267 cell-cell signaling; GO:0002250 adaptive immune response

Sequence Information

  • Sequence:  CLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
  • Length:  176
  • Propeptide:  MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA