General Information

  • ID:  hor007284
  • Uniprot ID:  Q9R1S9
  • Protein name:  Midkine
  • Gene name:  NA
  • Organism:  Rattus norvegicus
  • Family:  Pleiotrophin family
  • Source:  Animal
  • Expression:  Expressed at a low level in arteries; and at higher levels in newly formed neointima. In brain; expressed in the caudate nucleus and the brain stem.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0042995 cell projection; GO:0005576 extracellular region
  • GO BP:  GO:0035374 chondroitin sulfate binding; GO:0008083 growth factor activity; GO:0008201 heparin binding; GO:1904399 heparan sulfate binding
  • GO CC:  GO:0010718 positive regulation of epithelial to mesenchymal transition; GO:0051781 positive regulation of cell division; GO:1905555 positive regulation of blood vessel branching; GO:0061036 positive regulation of cartilage development; GO:0030335 positive regulation of cell migration; GO:1905653 positive regulation of artery morphogenesis; GO:0048477 oogenesis; GO:2000347 positive regulation of hepatocyte proliferation; GO:0045590 negative regulation of regulatory T cell differentiation; GO:0030279 negative regulation of ossification; GO:0045785 positive regulation of cell adhesion; GO:0045893 positive regulation of DNA-templated transcription; GO:0021987 cerebral cortex development; GO:0106016 positive regulation of inflammatory response to wounding; GO:0007614 short-term memory; GO:0009410 response to xenobiotic stimulus; GO:0009611 response to wounding; GO:0009725 response to hormone; GO:0051384 response to glucocorticoid; GO:0010996 response to auditory stimulus; GO:0032330 regulat

Sequence Information

  • Sequence:  AKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD
  • Length:  119
  • Propeptide:  MQHRSFFLLALVALLAVTTAVAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD
  • Signal peptide:  MQHRSFFLLALVALLAVTTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA