General Information

  • ID:  hor007266
  • Uniprot ID:  Q9HBE4
  • Protein name:  Interleukin-21
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  IL-15/IL-21 family
  • Source:  Human
  • Expression:  Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells; B-cells; or monocytes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005125 cytokine activity; GO:0005126 cytokine receptor binding; GO:0005134 interleukin-2 receptor binding
  • GO CC:  GO:0061470 T follicular helper cell differentiation; GO:0001819 positive regulation of cytokine production; GO:0002639 positive regulation of immunoglobulin production; GO:0050729 positive regulation of inflammatory response; GO:0032740 positive regulation of interleukin-17 production; GO:0045954 positive regulation of natural killer cell mediated cytotoxicity; GO:0042102 positive regulation of T cell proliferation; GO:0034105 positive regulation of tissue remodeling; GO:0007260 tyrosine phosphorylation of STAT protein; GO:0030890 positive regulation of B cell proliferation; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0002314 germinal center B cell differentiation; GO:0032729 positive regulation of type II interferon production; GO:0098586 cellular response to virus; GO:0048469 cell maturation; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0051607 defense response to virus

Sequence Information

  • Sequence:  KSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
  • Length:  137
  • Propeptide:  MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
  • Signal peptide:  MRSSPGNMERIVICLMVIFLGTLV
  • Modification:  T29 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA