General Information

  • ID:  hor007245
  • Uniprot ID:  Q99731
  • Protein name:  C-C motif chemokine 19
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Intercrine beta (chemokine CC) family
  • Source:  Human
  • Expression:  Expressed at high levels in the lymph nodes; thymus and appendix. Intermediate levels seen in colon and trachea; while low levels found in spleen; small intestine; lung; kidney and stomach.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0048020 CCR chemokine receptor binding; GO:0031735 CCR10 chemokine receptor binding; GO:0031732 CCR7 chemokine receptor binding; GO:0008009 chemokine activity; GO:0042379 chemokine receptor binding
  • GO CC:  GO:0060326 cell chemotaxis; GO:0001768 establishment of T cell polarity; GO:0002407 dendritic cell chemotaxis; GO:0070098 chemokine-mediated signaling pathway; GO:0048469 cell maturation; GO:0098586 cellular response to virus; GO:0007154 cell communication; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0006955 immune response; GO:0001771 immunological synapse formation; GO:0032731 positive regulation of interleukin-1 beta production; GO:0006874 intracellular calcium ion homeostasis; GO:0043507 positive regulation of JUN kinase activity; GO:0090023 positive regulation of neutrophil chemotaxis; GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0045860 positive regulation of protein kinase activity; GO:0048260 positive regulation of receptor-mediated endocytosis; GO:0034695 response to prostaglandin E; GO:0042102 pos

Sequence Information

  • Sequence:  TNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
  • Length:  76
  • Propeptide:  MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
  • Signal peptide:  MALLLALSLLVLWTSPAPTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA