General Information

  • ID:  hor007163
  • Uniprot ID:  Q2XXL8
  • Protein name:  Natriuretic peptide GNP1
  • Gene name:  RALFL34;At5g67070; K21H1.3;
  • Organism:  Varanus varius
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Paleoanguimorpha (Old World anguimorph lizards); Varanoidea; Varanidae (monitors); Varanus
  • GO MF:  GO:0005737 cytoplasm; GO:0005615 extracellular space
  • GO BP:  GO:0090729 toxin activity; GO:0051427 hormone receptor binding; GO:0005179 hormone activity
  • GO CC:  GO:0097746 blood vessel diameter maintenance; GO:0006182 cGMP biosynthetic process; GO:0019934 cGMP-mediated signaling; GO:0007218 neuropeptide signaling pathway; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0003085 negative regulation of systemic arterial blood pressure

Sequence Information

  • Sequence:  QPEGSCFGQKMDRIGHVSGMGCNKFDPNKGSSSTG
  • Length:  35
  • Propeptide:  MDPRLVRAGSLVLLLALLVQDQGAAHPARAGQKYKPLIRRSEEDSQALGQEGDVAARAADEEEDAAGPGDALRQPAFKTLLASREKRLQPEGSCFGQKMDRIGHVSGMGCNKFDPNKGSSSTGKK
  • Signal peptide:  MFHGSGLFALLLMVLEWTRPGLS
  • Modification:  T30 Sulfocysteine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA