General Information

  • ID:  hor007136
  • Uniprot ID:  Q16663
  • Protein name:  C-C motif chemokine 15
  • Gene name:  Gpha2; Gpa2, Zsig51;
  • Organism:  Homo sapiens
  • Family:  Intercrine beta (chemokine CC) family
  • Source:  Human
  • Expression:  Most abundant in heart; skeletal muscle and adrenal gland. Lower levels in placenta; liver; pancreas and bone marrow. CCL15
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0048020 CCR chemokine receptor binding; GO:0042056 chemoattractant activity; GO:0005102 signaling receptor binding; GO:0008009 chemokine activity; GO:0008201 heparin binding
  • GO CC:  GO:0006954 inflammatory response; GO:0007267 cell-cell signaling; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0006935 chemotaxis; GO:0048245 eosinophil chemotaxis; GO:0030335 positive regulation of cell migration; GO:0007165 signal transduction; GO:0006874 intracellular calcium ion homeostasis; GO:0070098 chemokine-mediated signaling pathway

Sequence Information

  • Sequence:  FTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  • Length:  91
  • Propeptide:  MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA