General Information

  • ID:  hor007082
  • Uniprot ID:  P61364
  • Protein name:  Osteocrin
  • Gene name:  FSHB
  • Organism:  Mus musculus
  • Family:  Osteocrin family
  • Source:  Animal
  • Expression:  Expressed in skeletal muscle and to a much lesser extent in bone; brown adipose tissue; spleen and testis (PubMed-14523025; PubMed-15044443; PubMed-26668395). Not expressed in neurons (PubMed-27830782
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  GO:0005615 extracellular space; GO:0005179; F:hormone activity
  • GO BP:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO CC:  GO:1903860 negative regulation of dendrite extension; GO:0030500 regulation of bone mineralization; GO:0001503 ossification; GO:0045668 negative regulation of osteoblast differentiation; GO:0046325 negative regulation of glucose import; GO:0003416 endochondral bone growth; GO:0007166 cell surface receptor signaling pathway; GO:0030154 cell differentiation; GO:0009755 hormone-mediated signaling pathway

Sequence Information

  • Sequence:  SVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG
  • Length:  104
  • Propeptide:  MLDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG
  • Signal peptide:  MLDWRLASTHFILAMIVMLWGSGKA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA