General Information

  • ID:  hor007076
  • Uniprot ID:  P56830??2-172)
  • Protein name:  Interferon tau-2
  • Gene name:  EPO
  • Organism:  Bos taurus
  • Family:  Alpha/beta interferon family
  • Source:  Human
  • Expression:  Constitutively and exclusively expressed in the mononuclear cells of the extraembryonic trophectoderm.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005125 cytokine activity; GO:0005179 hormone activity; GO:0005132 type I interferon receptor binding
  • GO CC:  GO:0043330 response to exogenous dsRNA; GO:0002250 adaptive immune response; GO:0030183 B cell differentiation; GO:0042100 B cell proliferation; GO:0019221 cytokine-mediated signaling pathway; GO:0051607 defense response to virus; GO:0007565 female pregnancy; GO:0006959 humoral immune response; GO:0002323 natural killer cell activation involved in immune response; GO:0033141 positive regulation of peptidyl-serine phosphorylation of STAT protein; GO:0002286 T cell activation involved in immune response

Sequence Information

  • Sequence:  YLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGQVMEEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRMEMMRALSSSTTLQKRLRKMGGDLNSL
  • Length:  171
  • Propeptide:  CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGQVMEEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRMEMMRALSSSTTLQKRLRKMGGDLNSL
  • Signal peptide:  NA
  • Modification:  T21 4-carboxyglutamate
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA