General Information

  • ID:  hor007073
  • Uniprot ID:  P56473
  • Protein name:  Agouti-related protein
  • Gene name:  NA
  • Organism:  Mus musculus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in arcuate nucleus and median eminence; adrenal gland (medulla); hypothalamus; testis; and lung.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005796 Golgi lumen; GO:0043025 neuronal cell body
  • GO BP:  GO:0031782 type 4 melanocortin receptor binding; GO:0005184 neuropeptide hormone activity; GO:0031781 type 3 melanocortin receptor binding; GO:0070996 type 1 melanocortin receptor binding
  • GO CC:  GO:0009755 hormone-mediated signaling pathway; GO:0042755 eating behavior; GO:0007623 circadian rhythm; GO:0008343 adult feeding behavior; GO:0060135 maternal process involved in female pregnancy; GO:0007218 neuropeptide signaling pathway; GO:2000253 positive regulation of feeding behavior; GO:0060259 regulation of feeding behavior; GO:0032868 response to insulin; GO:0048571 long-day photoperiodism

Sequence Information

  • Sequence:  PRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
  • Length:  49
  • Propeptide:  MLTAMLLSCVLLLALPPTLGVQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
  • Signal peptide:  MLTAMLLSCVLLLALPPTLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA