General Information

  • ID:  hor007051
  • Uniprot ID:  P48798
  • Protein name:  Fibroblast growth factor 2
  • Gene name:  tshb
  • Organism:  Monodelphis domestica
  • Family:  Heparin-binding growth factors family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Metatheria; Didelphimorphia; Didelphidae (opossums); Didelphinae; Monodelphis (short-tailed opossums); Monodelphis domestica (Gray short-tailed opossum)
  • GO MF:  NA
  • GO BP:  GO:0008083 growth factor activity; GO:0042056 chemoattractant activity; GO:0019956 chemokine binding; GO:0005125 cytokine activity; GO:0005104 fibroblast growth factor receptor binding; GO:0008201 heparin binding; GO:0090722 receptor-receptor interaction; GO:0005178 integrin binding; GO:0042802 identical protein binding; GO:0030374 nuclear receptor coactivator activity
  • GO CC:  GO:2000647 negative regulation of stem cell proliferation; GO:0061045 negative regulation of wound healing; GO:0007405 neuroblast proliferation; GO:0001759 organ induction; GO:0001649 osteoblast differentiation; GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0045766 positive regulation of angiogenesis; GO:0043536 positive regulation of blood vessel endothelial cell migration; GO:0090263 positive regulation of canonical Wnt signaling pathway; GO:0060045 positive regulation of cardiac muscle cell proliferation; GO:0051781 positive regulation of cell division; GO:0042660 positive regulation of cell fate specification; GO:0043537 negative regulation of blood vessel endothelial cell migration; GO:0060644 mammary gland epithelial cell differentiation; GO:1904977 lymphatic endothelial cell migration; GO:0030324 lung development; GO:0009887 animal organ morphogenesis; GO:0001658 branching involved in ureteric bud morphogenesis; GO:0060070 canonical Wnt signal

Sequence Information

  • Sequence:  ALSGDGGGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGIREKSDPNIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLALKYVTEECFFFERLESNNYNTYRSRKYSNWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Length:  146
  • Propeptide:  MAAGSITTLPALSGDGGGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGIREKSDPNIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLALKYVTEECFFFERLESNNYNTYRSRKYSNWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA