General Information

  • ID:  hor007032
  • Uniprot ID:  P41534
  • Protein name:  Growth hormone-releasing factor 1-46
  • Gene name:  NA
  • Organism:  Gallus gallus
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
  • GO MF:  GO:0016324 apical plasma membrane; GO:0016323 basolateral plasma membrane; GO:0005737 cytoplasm; GO:0005615 extracellular space
  • GO BP:  GO:0016521 pituitary adenylate cyclase activating polypeptide activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
  • GO CC:  GO:0032880 regulation of protein localization; GO:0010628 positive regulation of gene expression; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0031175 neuron projection development; GO:0030073 insulin secretion; GO:0060124 positive regulation of growth hormone secretion; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway

Sequence Information

  • Sequence:  KRHADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLS
  • Length:  48
  • Propeptide:  MSGNVYKTLLTLLVYGLIMHCNVYCSPDRWTPVPGAKLEEEVYDEDGNTLQDFALRAGAPGGGGPRPRWGRCTALYYPPGKRHADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLSKRHIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRVAYL
  • Signal peptide:  MSGNVYKTLLTLLVYGLIMHCNV
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA