General Information

  • ID:  hor007031
  • Uniprot ID:  P40933
  • Protein name:  Interleukin-15
  • Gene name:  CCK
  • Organism:  Homo sapiens
  • Family:  IL-15/IL-21 family
  • Source:  Human
  • Expression:  Most abundant in placenta and skeletal muscle. It is also detected in the heart; lung; liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005768 endosome; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0016607 nuclear speck; GO:0005654 nucleoplasm
  • GO BP:  GO:0005125 cytokine activity; GO:0005126 cytokine receptor binding
  • GO CC:  GO:0045580 regulation of T cell differentiation; GO:0001787 natural killer cell proliferation; GO:0007165 signal transduction; GO:0007260 tyrosine phosphorylation of STAT protein; GO:0120163 negative regulation of cold-induced thermogenesis; GO:0001819 positive regulation of cytokine production; GO:0001866 NK T cell proliferation; GO:0050691 regulation of defense response to virus by host; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0034105 positive regulation of tissue remodeling; GO:0042102 positive regulation of T cell proliferation; GO:1904100 positive regulation of protein O-linked glycosylation; GO:0050766 positive regulation of phagocytosis; GO:0042119 neutrophil activation; GO:0048469 cell maturation; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0032819 positive regulation of natural killer cell proliferation; GO:0032825 positive regulation of natural killer cell differentiation; GO:0032740 positive regulation of int

Sequence Information

  • Sequence:  WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
  • Length:  113
  • Propeptide:  MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
  • Signal peptide:  MRISKPHLRSISIQCYLCLLLNSHFLTEA
  • Modification:  T78 N6-succinyllysine; alternate
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA