General Information

  • ID:  hor007021
  • Uniprot ID:  P35070
  • Protein name:  Probetacellulin
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  NA
  • Source:  Human
  • Expression:  Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0030669 clathrin-coated endocytic vesicle membrane; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005886 plasma membrane
  • GO BP:  GO:0005154 epidermal growth factor receptor binding; GO:0008083 growth factor activity; GO:0030297 transmembrane receptor protein tyrosine kinase activator activity; GO:0048018 receptor ligand activity
  • GO CC:  GO:0045840 positive regulation of mitotic nuclear division; GO:0008283 cell population proliferation; GO:0007173 epidermal growth factor receptor signaling pathway; GO:1904019 epithelial cell apoptotic process; GO:0038134 ERBB2-EGFR signaling pathway; GO:0038138 ERBB4-ERBB4 signaling pathway; GO:1904036 negative regulation of epithelial cell apoptotic process; GO:0045597 positive regulation of cell differentiation; GO:0051781 positive regulation of cell division; GO:0048146 positive regulation of fibroblast proliferation; GO:0035810 positive regulation of urine volume; GO:0008284 positive regulation of cell population proliferation

Sequence Information

  • Sequence:  GNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
  • Length:  146
  • Propeptide:  MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
  • Signal peptide:  MDRAARCSGASSLPLLLALALGLVILHCVVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA