General Information

  • ID:  hor006986
  • Uniprot ID:  P24259
  • Protein name:  Natriuretic peptides A
  • Gene name:  Ndp; Ndph;
  • Organism:  Sus scrofa
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  [Atrial natriuretic peptide]- Brain (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig)
  • GO MF:  GO:0042995 cell projection; GO:0005737 cytoplasm; GO:0005615 extracellular space; GO:0043204 perikaryon
  • GO BP:  GO:0051427 hormone receptor binding; GO:0005179 hormone activity
  • GO CC:  GO:0003085 negative regulation of systemic arterial blood pressure; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0042311 vasodilation; GO:0019934 cGMP-mediated signaling; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0006182 cGMP biosynthetic process

Sequence Information

  • Sequence:  PVYGSVSNADLMDFKNLLDHLEDKMPLEDEAMPPQVLSEQNEEVGAPLSPLLEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
  • Length:  125
  • Propeptide:  MSSFTITVSFLLVLVFQFPGQTRANPVYGSVSNADLMDFKNLLDHLEDKMPLEDEAMPPQVLSEQNEEVGAPLSPLLEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
  • Signal peptide:  MSSFTITVSFLLVLVFQFPGQTRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA