General Information

  • ID:  hor006981
  • Uniprot ID:  P22618
  • Protein name:  Insulin-like growth factor
  • Gene name:  Il11
  • Organism:  Myxine glutinosa
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Cyclostomata (jawless vertebrates); Myxini; Myxiniformes; Myxinidae (hagfishes); Myxininae; Myxine; Myxine glutinosa (Atlantic hagfish)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0043539 protein serine/threonine kinase activator activity; GO:0005159 insulin-like growth factor receptor binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO CC:  GO:1905564 positive regulation of vascular endothelial cell proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0051147 regulation of muscle cell differentiation; GO:0042104 positive regulation of activated T cell proliferation; GO:0051781 positive regulation of cell division; GO:0046628 positive regulation of insulin receptor signaling pathway; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation

Sequence Information

  • Sequence:  SETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR
  • Length:  100
  • Propeptide:  YIRRVRQGSIYSLLVESQQWCKLTLTLLLLLALLTRCTLSETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR
  • Signal peptide:  YIRRVRQGSIYSLLVESQQWCKLTLTLLLLLALLTRCT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA