General Information

  • ID:  hor006963
  • Uniprot ID:  P19313
  • Protein name:  Cystatin-S
  • Gene name:  Apoc3
  • Organism:  Rattus norvegicus
  • Family:  Cystatin family
  • Source:  Animal
  • Expression:  Found in saliva; tears; urine and seminal fluid.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005737 cytoplasm; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0031982 vesicle
  • GO BP:  GO:0002020 protease binding; GO:0004869 cysteine-type endopeptidase inhibitor activity
  • GO CC:  GO:0048468 cell development; GO:0001906 cell killing; GO:0008285 negative regulation of cell population proliferation; GO:0046687 response to chromate; GO:0009725 response to hormone; GO:0014070 response to organic cyclic compound; GO:0001562 response to protozoan; GO:0009410 response to xenobiotic stimulus; GO:0007431 salivary gland development; GO:0048678 response to axon injury

Sequence Information

  • Sequence:  HFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI
  • Length:  113
  • Propeptide:  MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI
  • Signal peptide:  MAYLLHAQLFLLTTFILVLNMRLCPVL
  • Modification:  T32 Sulfocysteine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA