General Information

  • ID:  hor006955
  • Uniprot ID:  P15655
  • Protein name:  Fibroblast growth factor 2
  • Gene name:  cgba
  • Organism:  Mus musculus
  • Family:  Heparin-binding growth factors family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  NA
  • GO BP:  GO:0090722 receptor-receptor interaction; GO:0030374 nuclear receptor coactivator activity; GO:0008083 growth factor activity; GO:0042802 identical protein binding; GO:0008201 heparin binding; GO:0019956 chemokine binding; GO:0042056 chemoattractant activity; GO:0005178 integrin binding; GO:0005104 fibroblast growth factor receptor binding; GO:0005125 cytokine activity
  • GO CC:  GO:0030154 cell differentiation; GO:0060038 cardiac muscle cell proliferation; GO:0002042 cell migration involved in sprouting angiogenesis; GO:0060070 canonical Wnt signaling pathway; GO:0042060 wound healing; GO:0009887 animal organ morphogenesis; GO:0060978 angiogenesis involved in coronary vascular morphogenesis; GO:0001525 angiogenesis; GO:0008283 cell population proliferation; GO:0001658 branching involved in ureteric bud morphogenesis; GO:0071260 cellular response to mechanical stimulus; GO:0043410 positive regulation of MAPK cascade; GO:0060591 chondroblast differentiation; GO:2000546 positive regulation of endothelial cell chemotaxis to fibroblast growth factor; GO:0045893 positive regulation of DNA-templated transcription; GO:2000573 positive regulation of DNA biosynthetic process; GO:0021940 positive regulation of cerebellar granule cell precursor proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0021930 cerebellar granule cell precursor prol

Sequence Information

  • Sequence:  ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Length:  144
  • Propeptide:  MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA