General Information

  • ID:  hor006947
  • Uniprot ID:  P13432
  • Protein name:  SMR1 protein
  • Gene name:  gh2
  • Organism:  Rattus norvegicus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed predominantly in the acinar cells of the submandibular gland and to lesser extent in the prostate.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0030414 peptidase inhibitor activity; GO:0005179 hormone activity; GO:0004866 endopeptidase inhibitor activity
  • GO CC:  GO:0071222 cellular response to lipopolysaccharide; GO:0010466 negative regulation of peptidase activity; GO:0051930 regulation of sensory perception of pain

Sequence Information

  • Sequence:  RGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK
  • Length:  123
  • Propeptide:  MKSLYLIFGLWILLACFQSGEGVRGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK
  • Signal peptide:  MKSLYLIFGLWILLACFQSGEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA