General Information

  • ID:  hor006943
  • Uniprot ID:  P13085
  • Protein name:  Parathyroid hormone-related protein
  • Gene name:  NA
  • Organism:  Rattus norvegicus
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  NA
  • GO BP:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO CC:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0030282 bone mineralization; GO:0002062 chondrocyte differentiation; GO:0048286 lung alveolus development; GO:0001958 endochondral ossification; GO:0008284 positive regulation of cell population proliferation; GO:0001501 skeletal system development; GO:0010468 regulation of gene expression; GO:0007492 endoderm development; GO:0016485 protein processing; GO:0060659 nipple sheath formation; GO:0032330 regulation of chondrocyte differentiation; GO:0002076 osteoblast development; GO:0032331 negative regulation of chondrocyte differentiation; GO:0061182 negative regulation of chondrocyte development; GO:0060649 mammary gland bud elongation; GO:0060487 lung epithelial cell differentiation; GO:0043129 surfactant homeostasis

Sequence Information

  • Sequence:  VSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH
  • Length:  140
  • Propeptide:  MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH
  • Signal peptide:  MLRRLVQQWSVLVFLLSYSVPSRG
  • Modification:  T57 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA