General Information

  • ID:  hor006932
  • Uniprot ID:  P10147
  • Protein name:  C-C motif chemokine 3
  • Gene name:  FGF7; KGF;
  • Organism:  Homo sapiens
  • Family:  Intercrine beta (chemokine CC) family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0004672 protein kinase activity; GO:0016004 phospholipase activator activity; GO:0048020 CCR chemokine receptor binding; GO:0031726 CCR1 chemokine receptor binding; GO:0031730 CCR5 chemokine receptor binding; GO:0008009 chemokine activity; GO:0042802 identical protein binding; GO:0016301 kinase activity; GO:0042056 chemoattractant activity
  • GO CC:  GO:0050850 positive regulation of calcium-mediated signaling; GO:0030335 positive regulation of cell migration; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0010628 positive regulation of gene expression; GO:0050729 positive regulation of inflammatory response; GO:0032731 positive regulation of interleukin-1 beta production; GO:1903980 positive regulation of microglial cell activation; GO:0070098 chemokine-mediated signaling pathway; GO:2000503 positive regulation of natural killer cell chemotaxis; GO:0043525 positive regulation of neuron apoptotic process; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0032760 positive regulation of tumor necrosis factor production; GO:0050795 regulation of behavior; GO:0008360 regulation of cell shape; GO:0051930 regulation of sensory perception of pain; GO:0014808 release of sequestered calcium ion into cytosol by sarcoplasmic reticulum; GO:0070723 response to cholesterol; GO:0

Sequence Information

  • Sequence:  LAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
  • Length:  68
  • Propeptide:  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
  • Signal peptide:  MQVSTAALAVLLCTMALCNQFSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA