General Information

  • ID:  hor006915
  • Uniprot ID:  P08494
  • Protein name:  Matrix Gla protein
  • Gene name:  NA
  • Organism:  Rattus norvegicus
  • Family:  Osteocalcin/matrix Gla protein family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0062023 collagen-containing extracellular matrix; GO:0031012 extracellular matrix; GO:0005615 extracellular space; GO:0032991 protein-containing complex
  • GO BP:  GO:0048306 calcium-dependent protein binding; GO:0005509 calcium ion binding
  • GO CC:  GO:0030500 regulation of bone mineralization; GO:0051384 response to glucocorticoid; GO:0009725 response to hormone; GO:0009612 response to mechanical stimulus; GO:0007584 response to nutrient; GO:0065003 protein-containing complex assembly; GO:0001503 ossification; GO:0030324 lung development; GO:0030154 cell differentiation; GO:0051216 cartilage development; GO:0048754 branching morphogenesis of an epithelial tube; GO:0051592 response to calcium ion

Sequence Information

  • Sequence:  ESHESMESYEVSPFTTRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK
  • Length:  83
  • Propeptide:  MKSLLPLAILAALAVAALCYESHESMESYEVSPFTTRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK
  • Signal peptide:  MKSLLPLAILAALAVAALC
  • Modification:  T24 Pyrrolidone carboxylic acid; in short chain
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA