General Information

  • ID:  hor006895
  • Uniprot ID:  P04823
  • Protein name:  Interleukin-3
  • Gene name:  CALM1
  • Organism:  Rattus norvegicus
  • Family:  IL-3 family
  • Source:  Animal
  • Expression:  Activated T-cells; mast cells; natural killer cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005135 interleukin-3 receptor binding; GO:0005125 cytokine activity; GO:0008083 growth factor activity
  • GO CC:  GO:0033026 negative regulation of mast cell apoptotic process; GO:0033033 negative regulation of myeloid cell apoptotic process; GO:0030890 positive regulation of B cell proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0042098 T cell proliferation; GO:0046330 positive regulation of JNK cascade; GO:0070668 positive regulation of mast cell proliferation; GO:0002763 positive regulation of myeloid leukocyte differentiation; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0001666 response to hypoxia; GO:0035304 regulation of protein dephosphorylation; GO:0006110 regulation of glycolytic process; GO:0010468 regulation of gene expression; GO:0001558 regulation of cell growth; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:1901534 positive regulation of hematopoietic progenitor cell differentiation; GO:0009725 response to hormone; GO:0002573 myeloid leukocyte differentiation; GO:0010507 negative regulatio

Sequence Information

  • Sequence:  DRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
  • Length:  138
  • Propeptide:  MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
  • Signal peptide:  MVLASSTTSILCMLLPLLMLFHQGLQI
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA