General Information

  • ID:  hor006891
  • Uniprot ID:  P04342
  • Protein name:  Gamma-crystallin D
  • Gene name:  gcg
  • Organism:  Mus musculus
  • Family:  Beta/gamma-crystallin family
  • Source:  Animal
  • Expression:  Detected in the superior olivary complex of the auditory hindbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  GO:0005737 cytoplasm; GO:0005634 nucleus
  • GO BP:  GO:0005212 structural constituent of eye lens
  • GO CC:  GO:0007601 visual perception; GO:0070306 lens fiber cell differentiation; GO:0002088 lens development in camera-type eye; GO:0001654 eye development

Sequence Information

  • Sequence:  GKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIEFTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRVMDFY
  • Length:  173
  • Propeptide:  MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIEFTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRVMDFY
  • Signal peptide:  NA
  • Modification:  T10 Sulfocysteine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA