General Information

  • ID:  hor006863
  • Uniprot ID:  P01225
  • Protein name:  Follicle-stimulating hormone beta subunit
  • Gene name:  EPO
  • Organism:  Homo sapiens
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex
  • GO BP:  GO:0016913 follicle-stimulating hormone activity
  • GO CC:  GO:0007283 spermatogenesis; GO:0030335 positive regulation of cell migration; GO:0045780 positive regulation of bone resorption; GO:0010893 positive regulation of steroid biosynthetic process; GO:0007179 transforming growth factor beta receptor signaling pathway; GO:0007186 G protein-coupled receptor signaling pathway; GO:0042699 follicle-stimulating hormone signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0010628 positive regulation of gene expression; GO:0008284 positive regulation of cell population proliferation; GO:0007292 female gamete generation; GO:0006701 progesterone biosynthetic process; GO:0045670 regulation of osteoclast differentiation; GO:0010469 regulation of signaling receptor activity; GO:0060011 Sertoli cell proliferation; GO:0007565 female pregnancy

Sequence Information

  • Sequence:  NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
  • Length:  111
  • Propeptide:  MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
  • Signal peptide:  MKTLQFFFLFCCWKAICC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA