General Information

  • ID:  hor006857
  • Uniprot ID:  O93464
  • Protein name:  Cholecystokinin
  • Gene name:  LHB
  • Organism:  Carassius auratus
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in the ovary; kidney; gill; gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus; hypothalamus; telencephalon; olfactory bulb and tract; p
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO CC:  GO:0030072 peptide hormone secretion; GO:0030252 growth hormone secretion; GO:0007586 digestion; GO:0007631 feeding behavior

Sequence Information

  • Sequence:  LSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
  • Length:  104
  • Propeptide:  MNAGICVCVLLAALSTSSCLSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
  • Signal peptide:  MNAGICVCVLLAALSTSSC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA