General Information

  • ID:  hor006824
  • Uniprot ID:  O00253
  • Protein name:  Agouti-related protein
  • Gene name:  Reg3a; Pap2;
  • Organism:  Homo sapiens
  • Family:  NA
  • Source:  Human
  • Expression:  Expressed primarily in the adrenal gland; subthalamic nucleus; and hypothalamus; with a lower level of expression occurring in testis; lung; and kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity; GO:0070996 type 1 melanocortin receptor binding
  • GO CC:  GO:0008343 adult feeding behavior; GO:0007218 neuropeptide signaling pathway; GO:0007623 circadian rhythm; GO:0060259 regulation of feeding behavior; GO:0032868 response to insulin; GO:0048571 long-day photoperiodism; GO:2000253 positive regulation of feeding behavior; GO:0009755 hormone-mediated signaling pathway; GO:0060135 maternal process involved in female pregnancy; GO:0007631 feeding behavior; GO:0042755 eating behavior

Sequence Information

  • Sequence:  SRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
  • Length:  49
  • Propeptide:  MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
  • Signal peptide:  MLTAAVLSCALLLALPATRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA