General Information

  • ID:  hor006821
  • Uniprot ID:  I7C2V3
  • Protein name:  Spexin prohormone 1
  • Gene name:  CCL24
  • Organism:  Carassius auratus
  • Family:  Spexin family
  • Source:  Animal
  • Expression:  Expressed in the anterior hypothalamus; ventromedial thalamic nucleus and medial longitudinal fasciculus of the brain (at protein level). Widely expressed. Expressed predominantly in the spleen; kidne
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Cyprinidae; Cyprininae; Carassius; Carassius auratus (Goldfish)
  • GO MF:  GO:0005615 extracellular space; GO:0030133 transport vesicle
  • GO BP:  GO:0031765 type 2 galanin receptor binding; GO:0005184 neuropeptide hormone activity; GO:0031766 type 3 galanin receptor binding
  • GO CC:  GO:0032099 negative regulation of appetite; GO:0003084 positive regulation of systemic arterial blood pressure; GO:0035814 negative regulation of renal sodium excretion; GO:0010459 negative regulation of heart rate; GO:0051930 regulation of sensory perception of pain; GO:0044539 long-chain fatty acid import into cell; GO:0045944 positive regulation of transcription by RNA polymerase II

Sequence Information

  • Sequence:  PMGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESQSQNTENLSISKAAAFLLNVLQQARDEGEPY
  • Length:  75
  • Propeptide:  MKDLRTLAAYALALLLLATFVSYSRSAPMGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESQSQNTENLSISKAAAFLLNVLQQARDEGEPY
  • Signal peptide:  MKDLRTLAAYALALLLLATFVSYSRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  SPX-induce upregulation of incomplete feeding; goldfish SPX were effective in triggering a dose-dependent decrease in food consumption
  • Mechanism:  SPX-induce upregulation of incomplete feeding; goldfish SPX were effective in triggering a dose-dependent decrease in food consumption
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA