General Information

  • ID:  hor006820
  • Uniprot ID:  G7J032
  • Protein name:  Phytohormone-binding protein
  • Gene name:  SPX
  • Organism:  Medicago truncatula
  • Family:  BetVI family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Trifolieae; Medicago (medics); Medicago truncatula (Barrel medic) (Medicago tribuloides)
  • GO MF:  GO:0005737 cytoplasm; GO:0005634 nucleus
  • GO BP:  GO:0004864 protein phosphatase inhibitor activity; GO:0010427 abscisic acid binding; GO:0038023 signaling receptor activity
  • GO CC:  GO:0009738 abscisic acid-activated signaling pathway; GO:0006952 defense response; GO:0009740 gibberellic acid mediated signaling pathway

Sequence Information

  • Sequence:  IKEFNTQTTLNVGLEALWAAQSKDITLVVPKVLPNIVKDVQVIEGDGGVGTKLIFNFLPGIAPVNYQREVITEYDELSHTIGLQVVEGGYLNQGLSYYKTTFQFSAISENKTLVNVKISYDHESELIEEKVKPTKTSESTLFYLGQLEKFLLNGA
  • Length:  155
  • Propeptide:  MIKEFNTQTTLNVGLEALWAAQSKDITLVVPKVLPNIVKDVQVIEGDGGVGTKLIFNFLPGIAPVNYQREVITEYDELSHTIGLQVVEGGYLNQGLSYYKTTFQFSAISENKTLVNVKISYDHESELIEEKVKPTKTSESTLFYLGQLEKFLLNGA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Combined with general plant hormones
  • Mechanism:  Combined with general plant hormones
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA