General Information

  • ID:  hor006814
  • Uniprot ID:  C0HLU6
  • Protein name:  Humanin-like protein
  • Gene name:  Spx
  • Organism:  Rattus norvegicus
  • Family:  NA
  • Source:  Animal
  • Expression:  In the testis; expressed in Leydig cells at 10; 20 and 60 days of age (at protein level) (PubMed-16619233). Also expressed in pachytene spermatocytes at day 20 and in vessels; peritubular cells and sp
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:1904646 cellular response to amyloid-beta; GO:0043524 negative regulation of neuron apoptotic process; GO:0006915 apoptotic process; GO:0043066 negative regulation of apoptotic process

Sequence Information

  • Sequence:  AKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY
  • Length:  37
  • Propeptide:  MAKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide promoted the survival of Leydig cells in culture and interacted with IGF-I to stimulate DNA synthesis and steroidogenesis.
  • Mechanism:  This peptide promoted the survival of Leydig cells in culture and interacted with IGF-I to stimulate DNA synthesis and steroidogenesis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA