General Information

  • ID:  hor006787
  • Uniprot ID:  Q9YGP3
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  cga
  • Organism:  Ictalurus punctatus (Channel catfish) (Silurus punctatus)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ictalurus (genus), Ictaluridae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity; GO:0046982 protein heterodimerization activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  FPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSEKTMLVPKNITSEATCCVAKEVKRVIVNDVKLMNHTDCHCSTCYYHKF
  • Length:  92
  • Propeptide:  MILILKYTGATIILLSVLIEIGQLFPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSEKTMLVPKNITSEATCCVAKEVKRVIVNDVKLMNHTDCHCSTCYYHKF
  • Signal peptide:  MILILKYTGATIILLSVLIEIGQL
  • Modification:  NA
  • Glycosylation:  T53 N-linked (GlcNAc...) asparagine;T78 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-32; 11-61; 29-82; 33-84; 60-87
  • Structure ID:  AF-Q9YGP3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006787_AF2.pdbhor006787_ESM.pdb

Physical Information

Mass: 1210150 Formula: C455H710N124O134S13
Absent amino acids: W Common amino acids: CK
pI: 8.09 Basic residues: 15
Polar residues: 35 Hydrophobic residues: 23
Hydrophobicity: -34.67 Boman Index: -15318
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 56.09
Instability Index: 5635.76 Extinction Coefficient cystines: 6585
Absorbance 280nm: 72.36

Literature

  • PubMed ID:  9284560
  • Title:  Gonadotropin alpha-subunit glycoprotein from channel catfish (Ictalurus punctatus) and its expression during hormone-induced ovulation.