General Information

  • ID:  hor006784
  • Uniprot ID:  Q9PW99
  • Protein name:  Gonadotropin subunit beta-1
  • Gene name:  cgba
  • Organism:  Trichopodus trichopterus (Three spot gourami) (Trichogaster trichopterus)
  • Family:  Glycoprotein hormones subunit beta family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Trichopodus (genus), Luciocephalinae (subfamily), Osphronemidae (family), Anabantoidei (suborder), Anabantiformes (order), Anabantaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CRFGCHLTNISFPVDSCGITEFIYTTICAGHCYHEDPVYIGHDDWAEQKICNGDWTYEVKHLQGCPVAVTYPVARNCECTACNAGNTYCGHFHGYIPSCL
  • Length:  100
  • Propeptide:  MQLVVMAAVLAVAGVGQGCRFGCHLTNISFPVDSCGITEFIYTTICAGHCYHEDPVYIGHDDWAEQKICNGDWTYEVKHLQGCPVAVTYPVARNCECTACNAGNTYCGHFHGYIPSCL
  • Signal peptide:  MQLVVMAAVLAVAGVGQG
  • Modification:  NA
  • Glycosylation:  T9 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  5-51; 17-65; 28-77; 32-79; 82-89
  • Structure ID:  AF-Q9PW99-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006784_AF2.pdbhor006784_ESM.pdb

Physical Information

Mass: 1292364 Formula: C490H711N131O146S12
Absent amino acids: M Common amino acids: C
pI: 5.79 Basic residues: 11
Polar residues: 44 Hydrophobic residues: 28
Hydrophobicity: -9.1 Boman Index: -10253
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 62.4
Instability Index: 4829.2 Extinction Coefficient cystines: 22180
Absorbance 280nm: 224.04

Literature

  • PubMed ID:  10514555
  • Title:  Blue gourami (Trichogaster trichopterus) gonadotropic beta subunits (I and II) cDNA sequences and expression during oogenesis.