General Information

  • ID:  hor006783
  • Uniprot ID:  Q9PRL8
  • Protein name:  Acyl-CoA-binding protein
  • Gene name:  DBI
  • Organism:  Gallus gallus (Chicken)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  SEAAFQKAAEEVKELKSQPTDQEMLDVYSHYKQATVGDVNTDRPGMLDFKGKAKWDAWNALKGMSKEDAMKAYVAKVEELKGKYGI
  • Length:  86
  • Propeptide:  SEAAFQKAAEEVKELKSQPTDQEMLDVYSHYKQATVGDVNTDRPGMLDFKGKAKWDAWNALKGMSKEDAMKAYVAKVEELKGKYGI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PRL8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9PRL8-F1.pdbhor006783_AF2.pdbhor006783_ESM.pdb

Physical Information

Mass: 1116128 Formula: C427H670N112O134S4
Absent amino acids: C Common amino acids: K
pI: 5.89 Basic residues: 15
Polar residues: 19 Hydrophobic residues: 27
Hydrophobicity: -79.19 Boman Index: -16523
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.23
Instability Index: 2776.28 Extinction Coefficient cystines: 16960
Absorbance 280nm: 199.53

Literature

  • PubMed ID:  8609609
  • Title:  Fast and one-step folding of closely and distantly related homologous proteins of a four-helix bundle family.