General Information

  • ID:  hor006774
  • Uniprot ID:  Q9D258
  • Protein name:  Acyl-CoA-binding domain-containing protein 7
  • Gene name:  Acbd7
  • Organism:  Mus musculus (Mouse)
  • Family:  ACBD7 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process
  • GO CC:  GO:0005575 cellular_component

Sequence Information

  • Sequence:  MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKGLSKEDAMCAYISKARELIEKYGI
  • Length:  88
  • Propeptide:  MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKGLSKEDAMCAYISKARELIEKYGI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9D258-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9D258-F1.pdbhor006774_AF2.pdbhor006774_ESM.pdb

Physical Information

Mass: 1156261 Formula: C444H713N117O135S5
Absent amino acids: HT Common amino acids: KAL
pI: 5.17 Basic residues: 14
Polar residues: 18 Hydrophobic residues: 31
Hydrophobicity: -50.8 Boman Index: -15302
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.86
Instability Index: 5728.75 Extinction Coefficient cystines: 17085
Absorbance 280nm: 196.38

Literature

  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  19468303
  • Title:  Lineage-specific biology revealed by a finished genome assembly of the mouse.