General Information

  • ID:  hor006773
  • Uniprot ID:  Q9BQD1
  • Protein name:  Pro-MCH-like protein 2
  • Gene name:  PMCHL2
  • Organism:  Homo sapiens (Human)
  • Family:  Melanin-concentrating hormone family
  • Source:  Human
  • Expression:  Not expressed during brain development. |Expressed in testis but not in brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0008150 biological_process
  • GO CC:  GO:0005575 cellular_component; GO:0045202 synapse

Sequence Information

  • Sequence:  MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV
  • Length:  86(1-86)
  • Propeptide:  MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BQD1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9BQD1-F1.pdbhor006773_AF2.pdbhor006773_ESM.pdb

Physical Information

Mass: 1137256 Formula: C433H691N125O130S4
Absent amino acids: Common amino acids: L
pI: 8.75 Basic residues: 15
Polar residues: 25 Hydrophobic residues: 26
Hydrophobicity: -62.44 Boman Index: -19210
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.93
Instability Index: 3899.19 Extinction Coefficient cystines: 8605
Absorbance 280nm: 101.24

Literature

  • PubMed ID:  11181993
  • Title:  Birth of two chimeric genes in the Hominidae lineage.
  • PubMed ID:  8188237
  • Title:  Assignment of the human pro-melanin-concentrating hormone gene (PMCH) to chromosome 12q23-q24 and two variant genes (PMCH1 and PMCHL2) to chromosome 5p14 and 5q12-q13.
  • PubMed ID:  11070051
  • Title:  Structure and expression of the