General Information

  • ID:  hor006770
  • Uniprot ID:  Q93702
  • Protein name:  Putative uncharacterized protein flp-22
  • Gene name:  flp-22
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MNRSMIALCVVLMVSLVSAQVFDLDGQQLAGLEQNDARLMEQQVKRSPSAKWMRFGKRSPSAKWMRFGKRSPSAKWMRFGKRSGAEAVSEQDY
  • Length:  93(1-93)
  • Propeptide:  MNRSMIALCVVLMVSLVSAQVFDLDGQQLAGLEQNDARLMEQQVKRSPSAKWMRFGKRSPSAKWMRFGKRSPSAKWMRFGKRSGAEAVSEQDY
  • Signal peptide:  MNRSMIALCVVLMVSLVSA
  • Modification:  T55 Phenylalanine amide;T67 Phenylalanine amide;T79 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q93702-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q93702-F1.pdbhor006770_AF2.pdbhor006770_ESM.pdb

Physical Information

Mass: 1222646 Formula: C461H743N139O131S8
Absent amino acids: HT Common amino acids: S
pI: 11.12 Basic residues: 16
Polar residues: 21 Hydrophobic residues: 31
Hydrophobicity: -46.88 Boman Index: -19864
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.05
Instability Index: 8256.13 Extinction Coefficient cystines: 17990
Absorbance 280nm: 195.54

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  28847365
  • Title:  Luqin-like RYamide peptides regulate food-evoked responses in C. elegans.
  • PubMed ID:  16377032
  • Title:  FMRFamide related peptide ligands activate the Caenorhabditis elegans orphan GPCR Y59H11AL