HORDB

ID: hor006766
Uniprot ID: Q8WMW8
Protein name: Glycoprotein hormones alpha chain
Gene name: CGA
Organism: Capra hircus (Goat)
Family: Glycoprotein hormones subunit alpha family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Capra (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence: FPDGEFMMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVTGNVRVENHTDCHCSTCYYHKS
Length: 96(25-120)
Propeptide: MDYYRKYAAVILAVLSLFLQILHSFPDGEFMMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVTGNVRVENHTDCHCSTCYYHKS
Signal peptide: MDYYRKYAAVILAVLSLFLQILHS
Modification: NA
Glycosylation: T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006766_AF2.pdb

hor006766_ESM.pdb

Mass:	1247214	Formula:	C466H723N127O139S14
Absent amino acids:	W	Common amino acids:	CKT
pI:	8.41	Basic residues:	16
Polar residues:	38	Hydrophobic residues:	21
Hydrophobicity:	-46.56	Boman Index:	-16291
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	38.65
Instability Index:	4405.73	Extinction Coefficient cystines:	8075
Absorbance 280nm:	85