General Information

  • ID:  hor006756
  • Uniprot ID:  Q4U4N3
  • Protein name:  Alpha-latrotoxin-associated protein 2
  • Gene name:  NA
  • Organism:  Latrodectus tredecimguttatus (Mediterranean black widow spider) (Latrodectus mactans tredecimguttatus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Latrodectus (genus), Theridiidae (family), Araneoidea (superfamily), Orbiculariae , Entelegynae , Araneomorphae (suborder), Araneae (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MLKLICIAFLVTVLTLVAGQDSLDPAEFGCADDVNQAELLKNNDICLQCEDLHKEGVVFSLCKTNCFTTEYFQHCVKDLEEAKKEPPE
  • Length:  88(1-88)
  • Propeptide:  MLKLICIAFLVTVLTLVAGQDSLDPAEFGCADDVNQAELLKNNDICLQCEDLHKEGVVFSLCKTNCFTTEYFQHCVKDLEEAKKEPPE
  • Signal peptide:  MLKLICIAFLVTVLTLVAG
  • Modification:  T20 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana.
  • Mechanism:  Co-purifies with latroinsectotoxin.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  30-66; 46-62; 49-75
  • Structure ID:  AF-Q4U4N3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q4U4N3-F1.pdbhor006756_AF2.pdbhor006756_ESM.pdb

Physical Information

Mass: 1139039 Formula: C433H685N107O137S8
Absent amino acids: RW Common amino acids: L
pI: 4.15 Basic residues: 9
Polar residues: 22 Hydrophobic residues: 33
Hydrophobicity: 2.95 Boman Index: -9704
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 96.36
Instability Index: 2971.36 Extinction Coefficient cystines: 1865
Absorbance 280nm: 21.44

Literature

  • PubMed ID:  7570633
  • Title:  Low molecular weight components from black widow spider venom.