General Information

  • ID:  hor006748
  • Uniprot ID:  P80665
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Struthio camelus (Common ostrich)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Struthio (genus), Struthionidae (family), Struthioniformes (order), Palaeognathae (superorder), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS
  • Length:  96(1-96)
  • Propeptide:  FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-P80665-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P80665-F1.pdbhor006748_AF2.pdbhor006748_ESM.pdb

Physical Information

Mass: 1247618 Formula: C472H735N127O138S12
Absent amino acids: W Common amino acids: CKT
pI: 8.42 Basic residues: 16
Polar residues: 38 Hydrophobic residues: 23
Hydrophobicity: -38.23 Boman Index: -14962
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 49.79
Instability Index: 5308.75 Extinction Coefficient cystines: 6585
Absorbance 280nm: 69.32

Literature

  • PubMed ID:  8925835
  • Title:  Complete amino acid sequences of follitropin and lutropin in the ostrich, Struthio camelus.