General Information

  • ID:  hor006747
  • Uniprot ID:  P80051
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  cga
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex

Sequence Information

  • Sequence:  FPDDNFLTPGCPECRLKENLRFSNMGIGRIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS
  • Length:  97(1-97)
  • Propeptide:  FPDDNFLTPGCPECRLKENLRFSNMGIGRIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T57 N-linked (GlcNAc...) asparagine;T83 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-36; 14-65; 33-87; 37-89; 64-92
  • Structure ID:  AF-P80051-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P80051-F1.pdbhor006747_AF2.pdbhor006747_ESM.pdb

Physical Information

Mass: 1274835 Formula: C472H753N137O140S14
Absent amino acids: W Common amino acids: C
pI: 8.71 Basic residues: 17
Polar residues: 40 Hydrophobic residues: 21
Hydrophobicity: -44.33 Boman Index: -19066
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 55.26
Instability Index: 4327.42 Extinction Coefficient cystines: 8075
Absorbance 280nm: 84.11

Literature

  • PubMed ID:  1730225
  • Title:  Amphibian lutropin and follitropin from the bullfrog Rana catesbeiana. Complete amino acid sequence of the alpha subunit.
  • PubMed ID:  1701134
  • Title:  The antigenic structure of the human glycoprotein hormone alpha-subunit: II. Cross-species comparisons.