General Information

  • ID:  hor006740
  • Uniprot ID:  P58294
  • Protein name:  Prokineticin-1
  • Gene name:  PROK1
  • Organism:  Homo sapiens (Human)
  • Family:  AVIT (prokineticin) family
  • Source:  Human
  • Expression:  In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis.|Localizes to glandular epithelium, stroma and vascular
  • Disease:  Diseases associated with PROK1 include Neuroblastoma and Endocervicitis.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0001525 angiogenesis; GO:0001935 endothelial cell proliferation; GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045765 regulation of angiogenesis; GO:0051781 positive regulation of cell division; GO:0101023 vascular endothelial cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
  • Length:  86(20-105)
  • Propeptide:  MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
  • Signal peptide:  MRGATRVSIMLLLVTVSDC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of oth
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PROKR2
  • Target Unid:   Q8NFJ6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-P58294-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006740_AF2.pdbhor006740_ESM.pdb

Physical Information

Mass: 1118365 Formula: C414H660N130O114S12
Absent amino acids: Common amino acids: CR
pI: 8.58 Basic residues: 17
Polar residues: 30 Hydrophobic residues: 23
Hydrophobicity: -28.72 Boman Index: -16525
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 64.65
Instability Index: 5125.23 Extinction Coefficient cystines: 7615
Absorbance 280nm: 89.59

Literature

  • PubMed ID:  11259612
  • Title:  Identification of two prokineticin cDNAs: recombinant proteins potently contract gastrointestinal smooth muscle.
  • PubMed ID:  11528470
  • Title:  Identification of an angiogenic mitogen selective for endocrine gland endothelium.
  • PubMed ID:  12975309
  • Title:  The secreted protein discovery initiative (SPDI), a large
  • PubMed ID:  16710414
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  15340161
  • Title:  
  • PubMed ID:  15292351
  • Title:  
  • PubMed ID:  17289879
  • Title:  
  • PubMed ID:  18339712
  • Title: