General Information

  • ID:  hor006739
  • Uniprot ID:  P56702
  • Protein name:  Diazepam-binding inhibitor-like 5
  • Gene name:  Dbil5
  • Organism:  Rattus norvegicus (Rat)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  Specifically expressed in late haploid male germ cells.|Testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process; GO:0006637 acyl-CoA metabolic process; GO:0007283 spermatogenesis
  • GO CC:  GO:0005737 cytoplasm

Sequence Information

  • Sequence:  MSQVEFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKMDAMRIYIAKVEELKKNETC
  • Length:  87
  • Propeptide:  MSQVEFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKMDAMRIYIAKVEELKKNETC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the energy metabolism of the mature sperm.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P56702-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P56702-F1.pdbhor006739_AF2.pdbhor006739_ESM.pdb

Physical Information

Mass: 1139775 Formula: C436H700N112O129S9
Absent amino acids: H Common amino acids: K
pI: 8.47 Basic residues: 13
Polar residues: 20 Hydrophobic residues: 28
Hydrophobicity: -40.23 Boman Index: -12063
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.69
Instability Index: 5595.75 Extinction Coefficient cystines: 15595
Absorbance 280nm: 181.34

Literature

  • PubMed ID:  10415332
  • Title:  Rat endozepine-like peptide (ELP): cDNA cloning, genomic organization and tissue-specific expression.